PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 240aa    MW: 27325 Da    PI: 7.6597
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14917.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH444.1e-1462114155
                 CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
         HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                 ++ +hn+ Er RR++iN+  + Lr+llP a   + kK+s  +++ ++++YI +Lq
  KHN14917.1  62 KKLSHNASERDRRKKINNLVSSLRSLLPVA--DQTKKMSIPATVSRVIKYIPELQ 114
                 6789*************************6..48888***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.51361113IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.54E-1362118No hitNo description
Gene3DG3DSA:4.10.280.102.2E-1362127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.0E-1162114IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.09E-1662132IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003536.0E-1167119IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MVALFSPPVF STKGWLLEEE PLSYDVSSEY SFPYQFYSPQ TQIEVEIESS TAPSPDDPAM  60
VKKLSHNASE RDRRKKINNL VSSLRSLLPV ADQTKKMSIP ATVSRVIKYI PELQQQVQSL  120
TKKKEVLLWR ISRQLQGDAV NKESQRKISQ HNSEFVVSTS RLNDCEVVVH ISYEAQKAPL  180
SEILHCLENN GLYLLNGSSS ETFGGRAFHN LHFQVEKTQR LESGILTENL LSIYQNQRIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311010.0KT031101.1 Glycine max clone HN_CCL_45 bHLH transcription factor (Glyma03g28630.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521149.11e-148PREDICTED: transcription factor ORG3-like
TrEMBLA0A0B2Q5281e-177A0A0B2Q528_GLYSO; Transcription factor ORG2
STRINGGLYMA03G28630.11e-147(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.16e-48bHLH family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]